PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00672.1.g00380.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 964aa    MW: 104027 Da    PI: 8.2803
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00672.1.g00380.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding31.44.3e-10662707146
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                   +g+W +eEd  l + v+++G  +W++I ++  + R +k+c++rw +
  Zmw_sc00672.1.g00380.1.am.mk 662 KGPWLPEEDAVLRRHVAEHGEQDWSSIQSKGLLDRPGKSCRLRWVN 707
                                   79*************************999889***********87 PP

2Myb_DNA-binding38.33.2e-12727768245
                                   SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
               Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                                   g++++eE+   +d+ +q G++ W+ Ia ++  gRt++++k++w 
  Zmw_sc00672.1.g00380.1.am.mk 727 GKFSPEEERVVLDLQAQVGNK-WAMIATHLH-GRTDNDVKNFWS 768
                                   79*******************.*********.***********5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF510115.04E-9887No hitNo description
Gene3DG3DSA:2.60.40.11807.2E-11987IPR013780Glycosyl hydrolase, all-beta
Gene3DG3DSA:3.90.550.101.2E-64329598IPR029044Nucleotide-diphospho-sugar transferases
PfamPF092584.2E-67332595IPR015338Exostosin , C-terminal
PROSITE profilePS5129419.855657713IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.2E-17658714IPR009057Homeodomain-like
SuperFamilySSF466892.46E-23660767IPR009057Homeodomain-like
SMARTSM007173.9E-9661711IPR001005SANT/Myb domain
PfamPF002493.6E-9662707IPR001005SANT/Myb domain
CDDcd001673.67E-9664709No hitNo description
PROSITE profilePS5129418.938721775IPR017930Myb domain
SMARTSM007172.6E-10725773IPR001005SANT/Myb domain
PfamPF002491.0E-9727768IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.8E-16727770IPR009057Homeodomain-like
CDDcd001679.07E-8728767No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006024Biological Processglycosaminoglycan biosynthetic process
GO:0015012Biological Processheparan sulfate proteoglycan biosynthetic process
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 964 aa     Download sequence    Send to blast
MVGIAWAQND ETKGEIYVAF NTSHLPVVVG LPERPGYRWE PVVDTGKPAP YDFMSDDLPD  60
RALIVHQFSH FLTSNIYPML SYSSIILAIT HGLAGWAAAV DPAGLGLDVV LLPLAEVAEQ  120
PPRAAATFAH YTFFLGTSHN DTVNLHAGIG RIAATPPPPA ARPAPRPRWR RAPAARMRSR  180
SSTSSSPVAA AMPGTATAAS CSATALCSCP GAQAPRCSMA APLLRLPAGA GLGRSLRTTP  240
SPLVDKLARE RLSESDVRAH VNPPRITTTG PPPISPPRRL PSMPPRSRHR LRLLLRLRLL  300
FLFLVELPVV AFARIGGVKE DPDEALPRPD RLTVLLSGYS ERRLPLLRAI TGAYSAHPLV  360
LSVVVIWCNP ATPDRVLHGG GGFPPLVTLH RAASASLNSR FLPNSAILTS AVAVADDDVL  420
PDAAALSFAF AAWQQQAARS GGALVGFFPR SHHLDLARGR WAYAGAEPGR YSMVLTKFMV  480
LGTDLLRKYS CSPELAAARA VVDRVRNCED ILMNFVAADE FGQGPVLVEA GSVRDWGDPR  540
NDANASGDGE EGGATKDVGL SSTGGTGHWE KRGECITEFH RLLGRMPLRY SYGKLVEAAV  600
GEQGLCSKGG RLVRCDQDPG ELGTARTESA SLAWSRWPRA GGERARMPPR RRGGGDRPAV  660
KKGPWLPEED AVLRRHVAEH GEQDWSSIQS KGLLDRPGKS CRLRWVNKLQ PGLKYYAFLY  720
SSILSGGKFS PEEERVVLDL QAQVGNKWAM IATHLHGRTD NDVKNFWSTR QKRLARLLQE  780
PPPRRRAVRQ NSSSASSARC PELRARLQEP CSSITTFHAS TYDGGQSSSQ EPNEVEHGVD  840
SRLPGALCLP APVDSAVGRG SPSVVPSDET CAGDRAVGLA SLHHAAFVEP LAAVPTALSF  900
GPEDGFVLCD NEAHCIEPQP LVVIPADPFL HDEYFAAAAA PRRDTSGLCF DDLTPEMLDF  960
FEQM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-2165877323126MYB TRANSFORMING PROTEIN
1on8_B9e-2033059128275Alpha-1,4-N-acetylhexosaminyltransferase EXTL
1on8_A9e-2033059128275Alpha-1,4-N-acetylhexosaminyltransferase EXTL
1on6_B9e-2033059128275Alpha-1,4-N-acetylhexosaminyltransferase EXTL
1on6_A9e-2033059128275Alpha-1,4-N-acetylhexosaminyltransferase EXTL
1omz_B9e-2033059128275Alpha-1,4-N-acetylhexosaminyltransferase EXTL
1omz_A9e-2033059128275Alpha-1,4-N-acetylhexosaminyltransferase EXTL
1omx_B9e-2033059128275Alpha-1,4-N-acetylhexosaminyltransferase EXTL
1omx_A9e-2033059128275Alpha-1,4-N-acetylhexosaminyltransferase EXTL
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1263434